PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun006552
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 129aa    MW: 14400.4 Da    PI: 6.2666
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-15711PU_refplantGDBView CDS
gnl|UG|Vun#S45803954PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB182.43.8e-5719114297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdr+lPianv+rimkkvlP+nakisk++ket+qecvsefisfvt+easdkcq+ekrktingddllwa+a+lGfedy+eplk+yl+kyre+egek
  Vun006552  19 REQDRLLPIANVGRIMKKVLPGNAKISKESKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMASLGFEDYAEPLKAYLHKYREMEGEK 114
                89********************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-5314117IPR009072Histone-fold
SuperFamilySSF471132.33E-4121124IPR009072Histone-fold
PfamPF008089.4E-282488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.0E-225270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.0E-227189No hitNo description
PRINTSPR006159.0E-2290108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MAESDNESGG GKNESSICRE QDRLLPIANV GRIMKKVLPG NAKISKESKE TMQECVSEFI  60
SFVTGEASDK CQKEKRKTIN GDDLLWAMAS LGFEDYAEPL KAYLHKYREM EGEKTAMIGK  120
HHGLYANPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4719109292Transcription factor HapC (Eurofung)
4g91_B2e-4719109292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507678.14e-90PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233103e-65NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0L9TT482e-90A0A0L9TT48_PHAAN; Uncharacterized protein
STRINGGLYMA09G01650.11e-70(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-66nuclear factor Y, subunit B3